PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013192.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 219aa    MW: 24823 Da    PI: 10.3293
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013192.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.4e-1582142363
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 elkr rr+++NR++A+rsRqRK++ ++ L   v++L +  ++L+  l++ ++++a+ ++++
  Do013192.1  82 ELKRKRRMESNRVSAKRSRQRKQQHLDDLNSQVDQLRTTKQQLITALNNTTQNYAAAEAQN 142
                 79***************************************************99888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1380144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.382145IPR004827Basic-leucine zipper domain
PfamPF001702.9E-1282138IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.38E-1183136No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-1184157No hitNo description
CDDcd147024.59E-1585136No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MSQILLDASR SRFMINSTLR RGTHLVLSFS VVFLYWFYVF SKNLLRMTLS GGTFSSGTSS  60
GSSHGTHSFG SEGDMELQAR MELKRKRRME SNRVSAKRSR QRKQQHLDDL NSQVDQLRTT  120
KQQLITALNN TTQNYAAAEA QNSVLRTQMI ELESRLSALR DIIYYMNANQ VSNAATINAN  180
PSTIISTTAN YDPFGTSAWN SGMQQMVQQP IDHLLYQCF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196101KRSRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9567493e-42EU956749.1 Zea mays clone 1572457 light-inducible protein CPRF-2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445402.16e-96hypothetical protein SORBIDRAFT_07g015450
TrEMBLC5YKC06e-96C5YKC0_SORBI; Putative uncharacterized protein Sb07g015450
STRINGSb07g015450.12e-95(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.12e-23G-box binding factor 6